PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_36762
Common NameKK1_041215
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family Nin-like
Protein Properties Length: 345aa    MW: 39238.9 Da    PI: 4.8378
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_36762genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK55.61e-17296342349
         RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRki 49 
                    k ++led s yF+l+i +AA++L+vc ++LK  CR+++++ WPhRk+
  C.cajan_36762 296 KAMKLEDCSDYFHLTIGAAAQKLDVCISALKSLCRRNNLENWPHRKV 342
                    7899******************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151913.765285345IPR003035RWP-RK domain
PfamPF020421.8E-15298342IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MDNNNFGFVS YDDEDPFLCP LIPNLLVEVD PSLVLPKAQP HQQNDHPFGL QHGNNVPFTI  60
QDQFMQDNNN NGEVANFDVE SRGQQTMHVD GSNNISNEGG VGNFEIEGRG QTMHGDGSNN  120
IFNEGRVVTS VSYWPLIPRP FFCTCCQVLR QIIHTNGVQF EKLEIHGTIG VMGHAIIQNR  180
NITQGDHPSS DPHQIIDFHY RSTEQIKSFM VEYCTQMSKL GYIIVEDVLS TYYEILCTGV  240
DWAKDTSDED IDLIPSNDMG QDFEPEPQPQ HEPEPEAVNL KRKRRRPDAE QRKRIKAMKL  300
EDCSDYFHLT IGAAAQKLDV CISALKSLCR RNNLENWPHR KVPML
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1279286LKRKRRRP
2280285KRKRRR
3281285RKRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A151R5110.0A0A151R511_CAJCA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF74782846
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.16e-09RWP-RK domain-containing protein